∞ forever components

De Stijl Neoplastic

Boogie Pulse

26 primary-color blocks travel and blink along a black asymmetric De Stijl grid over static color-field plaques, evoking neoplastic's Broadway Boogie-Woogie.

canvasmedium complexitymoderate motion

Open on the canvas to copy the code → Free account · 3 copies a day · membership goes unlimited

Live demo — the real component, running in a sandbox. One self-contained HTML file, zero dependencies. Open it on the canvas →
Worth keeping? Votes steer what gets built next — sign in to cast one, free to read

When to use it

Art/design-themed hero backgrounds, creative portfolios, or anywhere a bold geometric ambient loop fits.

When not to

Content-heavy layouts where bright flashing primary blocks compete with readable text. Low-end mobile where canvas loops add frame-rate pressure.

Working with an AI agent

Every component ships agent-ready metadata. An example instruction for this one:

Change block count to 40 by setting N=40, shift palette to warm tones by swapping BLUE to '#e05c00', and slow travel speed by changing the 0.0166 multiplier to 0.010. Theme: dark tokens live in :root, the light variant in :root[data-theme="light"]; ?theme=light or a {type:'forever:theme'} postMessage switches at runtime.

Safe to edit

  • block count (N=26)
  • travel speed multiplier (0.0166)
  • blink threshold (Math.sin > 0.35)
  • color palette (BLUE/RED/YELLOW constants)
  • grid line fractions (VX / HY arrays)
  • plaque color assignments (PLAQUES array)
  • theme tokens (:root dark defaults + [data-theme=light] overrides)

Keep intact

  • IIFE wrapper
  • prefers-reduced-motion guard (reduce branch + static frame(0))
  • visibilitychange stop/start
  • DPR-aware canvas sizing with ctx.setTransform
  • theme hook (?theme= bootstrap + forever:theme message listener + theme tokens)

Known limitations

  • Blink is a hard on/off step function — may read as strobing on very large screens
  • Grid proportions are fixed fractions; asymmetric layout breaks if VX/HY arrays are reordered carelessly

de-stijlneoplasticgridcanvastrafficprimary-colorsambient

More De Stijl Neoplastic components

  • Grid RecomposeBlack grid lines slide between asymmetric positions with cubic easing, repartitioning red, blue, yellow, and off-white rectangles in neoplastic style.
  • Block FillPrimary-color rectangles wipe and rise in staggered sequence to fill cells of an asymmetric black De Stijl grid on warm white; loops continuously.
  • Line WeaveHorizontal and vertical cream lines thread and interlace over primary-color blocks on a dark field, with bright nodes at crossing points during the weave…
  • Dynamic EquilibriumSix neoplastic-colored rectangles hang from a tilting beam; a spring-damper drives it toward equilibrium while a slow bias keeps it gently alive.
  • Counter CompositionA neoplastic grid of red, blue, and yellow cells divided by black bars rotates from 38° and settles to a gentle 15° resting angle with a slow living drift.
  • Split PlaneA square canvas splits along alternating seams; two halves slide apart and reflow into new De Stijl primary-color compositions every 4.4 s.