∞ forever components

De Stijl Neoplastic

Line Weave

Horizontal and vertical cream lines thread and interlace over primary-color blocks on a dark field, with bright nodes at crossing points during the weave sweep.

canvasmedium complexitymoderate motion

Open on the canvas to copy the code → Free account · 3 copies a day · membership goes unlimited

Live demo — the real component, running in a sandbox. One self-contained HTML file, zero dependencies. Open it on the canvas →
Worth keeping? Votes steer what gets built next — sign in to cast one, free to read

When to use it

Art/design portfolio heroes, geometric or neoplastic-inspired brand contexts, ambient dashboard backgrounds needing a structured, calm motion loop.

When not to

Contexts requiring readable text overlays — the crossing node flashes compete with content. Not suited for light-background UIs (background is hardcoded dark).

Working with an AI agent

Every component ships agent-ready metadata. An example instruction for this one:

Change VX to [0.25, 0.50, 0.75] for an even three-column grid, swap BLUE to '#6B21A8' (purple), and slow the cycle by setting P=12.0. Theme: dark tokens live in :root, the light variant in :root[data-theme="light"]; ?theme=light or a {type:'forever:theme'} postMessage switches at runtime.

Safe to edit

  • vertical line positions (VX array)
  • horizontal line positions (HY array)
  • color block definitions (BLOCKS array)
  • cycle duration (P=8.0)
  • line weight scale (S*0.018)
  • theme tokens (:root dark defaults + [data-theme=light] overrides)

Keep intact

  • DPR-aware canvas sizing
  • visibilitychange pause/play
  • reduced-motion drawOneFrame() fallback
  • IIFE wrapper
  • theme hook (?theme= bootstrap + forever:theme message listener + theme tokens)

Known limitations

  • Background color hardcoded to dark (#0e0e10) — must edit CSS var to change
  • Interlace over/under effect is visual only (draw order trick), not true clipping

de-stijlneoplasticgridweavecanvasprimary-colorsgeometric

More De Stijl Neoplastic components

  • Grid RecomposeBlack grid lines slide between asymmetric positions with cubic easing, repartitioning red, blue, yellow, and off-white rectangles in neoplastic style.
  • Boogie Pulse26 primary-color blocks travel and blink along a black asymmetric De Stijl grid over static color-field plaques, evoking neoplastic's Broadway Boogie-Woogie.
  • Block FillPrimary-color rectangles wipe and rise in staggered sequence to fill cells of an asymmetric black De Stijl grid on warm white; loops continuously.
  • Dynamic EquilibriumSix neoplastic-colored rectangles hang from a tilting beam; a spring-damper drives it toward equilibrium while a slow bias keeps it gently alive.
  • Counter CompositionA neoplastic grid of red, blue, and yellow cells divided by black bars rotates from 38° and settles to a gentle 15° resting angle with a slow living drift.
  • Split PlaneA square canvas splits along alternating seams; two halves slide apart and reflow into new De Stijl primary-color compositions every 4.4 s.